missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | SLA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLA2 Polyclonal specifically detects SLA2 in Human samples. It is validated for Western Blot.Specifications
| SLA2 | |
| Polyclonal | |
| Rabbit | |
| NP_115590 | |
| 84174 | |
| Synthetic peptide directed towards the N terminal of human SLA2The immunogen for this antibody is SLA2. Peptide sequence GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C20orf156, FLJ21992, Modulator of antigen receptor signaling, SLAP-2MARS, SLAP2MGC49845, Src-like adapter protein 2, Src-like adapter protein-2, src-like-adapter 2, Src-like-adaptor 2 | |
| SLA2 | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title