SLA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79829

Product Code. 18249935

Description

SLA2 Polyclonal specifically detects SLA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C20orf156, FLJ21992, Modulator of antigen receptor signaling, SLAP-2MARS, SLAP2MGC49845, Src-like adapter protein 2, Src-like adapter protein-2, src-like-adapter 2, Src-like-adaptor 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Research Discipline: Immunology, Signal Transduction
• Gene ID (Entrez): 84174
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115590
• Gene Symbols: SLA2
• Immunogen: Synthetic peptide directed towards the N terminal of human SLA2The immunogen for this antibody is SLA2. Peptide sequence GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG