missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIX3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35744-20ul
This item is not returnable.
View return policy
Description
SIX3 Polyclonal antibody specifically detects SIX3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| SIX3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| holoprosencephaly 2, alobar or semilobar, homeobox protein SIX3, HPE2, Sine oculis homeobox homolog 3, sine oculis homeobox homolog 3 (Drosophila), SIX homeobox 3 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-336 of human SIX3 (NP_005404.1).,, Sequence:, VGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6496 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction