missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIX3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | SIX3 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231804
|
Novus Biologicals
NBP3-35744-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229226
|
Novus Biologicals
NBP3-35744-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SIX3 Polyclonal antibody specifically detects SIX3 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| SIX3 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| holoprosencephaly 2, alobar or semilobar, homeobox protein SIX3, HPE2, Sine oculis homeobox homolog 3, sine oculis homeobox homolog 3 (Drosophila), SIX homeobox 3 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-336 of human SIX3 (NP_005404.1).,, Sequence:, VGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6496 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title