missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIK1/Snf1lk Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | SIK1/Snf1lk |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18125068
|
Novus Biologicals
NBP2-38397 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671976
|
Novus Biologicals
NBP2-38397-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SIK1/Snf1lk Polyclonal specifically detects SIK1/Snf1lk in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SIK1/Snf1lk | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P57059 | |
| 150094 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.7.11, EC 2.7.11.1, msk, myocardial SNF1-like kinase, salt-inducible kinase 1, Salt-inducible protein kinase 1, serine/threonine protein kinase, serine/threonine-protein kinase SIK1, Serine/threonine-protein kinase SNF1-like kinase 1, Serine/threonine-protein kinase SNF1LK, SIK, SIK-1, SNF1-like kinase, SNF1LKMSK | |
| SIK1 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title