SIK1/Snf1lk Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38397

Product Code. 18125068

Description

SIK1/Snf1lk Polyclonal specifically detects SIK1/Snf1lk in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SIK1/Snf1lk
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P57059
• Gene Symbols: SIK1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF
• Quantity: 0.1 mL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 150094
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.1, msk, myocardial SNF1-like kinase, salt-inducible kinase 1, Salt-inducible protein kinase 1, serine/threonine protein kinase, serine/threonine-protein kinase SIK1, Serine/threonine-protein kinase SNF1-like kinase 1, Serine/threonine-protein kinase SNF1LK, SIK, SIK-1, SNF1-like kinase, SNF1LKMSK
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.