missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Siglec-7/CD328 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Siglec-7/CD328 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Siglec-7/CD328 Polyclonal specifically detects Siglec-7/CD328 in Human samples. It is validated for Western Blot.Specifications
| Siglec-7/CD328 | |
| Polyclonal | |
| Rabbit | |
| Q9Y286 | |
| 27036 | |
| Synthetic peptides corresponding to SIGLEC7(sialic acid binding Ig-like lectin 7) The peptide sequence was selected from the middle region of SIGLEC7. Peptide sequence WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Adhesion inhibitory receptor molecule 1, adhesion inhibitory receptor molecule 1, siglec-7, AIRM-1, AIRM1QA79 membrane protein, CD328, CD328 antigen, CDw328, D-siglec, p75, p75/AIRM1, QA79, sialic acid binding Ig-like lectin 7, sialic acid binding immunoglobulin-like lectin 7, sialic acid-binding Ig-like lectin 7, Siglec-7 | |
| SIGLEC7 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title