missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SHC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SHC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SHC3 Polyclonal specifically detects SHC3 in Mouse samples. It is validated for Western Blot.Specifications
| SHC3 | |
| Polyclonal | |
| Rabbit | |
| NP_033193 | |
| 53358 | |
| Synthetic peptide directed towards the N terminal of human Shc3The immunogen for this antibody is Shc3. Peptide sequence PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transforming protein C, src homology 2 domain-containing transforming protein C3, Src homology 2 domain-containing-transforming protein C3 | |
| SHC3 | |
| IgG | |
| 52 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title