missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SH3MD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SH3MD2 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18623729
|
Novus Biologicals
NBP2-68988-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18684548
|
Novus Biologicals
NBP2-68988 |
100 μg |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SH3MD2 Polyclonal antibody specifically detects SH3MD2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| SH3MD2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol | |
| 57630 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 6.3.2, EC 6.3.2.-, KIAA1494SH3 multiple domains protein 2, Plenty of SH3s, POSHFLJ21602, Protein POSH, putative E3 ubiquitin-protein ligase SH3RF1, RING finger protein 142, RNF142plenty of SH3 domains, SH3 domain containing ring finger 1, SH3 domain-containing RING finger protein 1, SH3 multiple domains 2, SH3MD2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title