SH3MD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68988

Product Code. 18684548

Description

SH3MD2 Polyclonal antibody specifically detects SH3MD2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: SH3MD2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: EC 6.3.2, EC 6.3.2.-, KIAA1494SH3 multiple domains protein 2, Plenty of SH3s, POSHFLJ21602, Protein POSH, putative E3 ubiquitin-protein ligase SH3RF1, RING finger protein 142, RNF142plenty of SH3 domains, SH3 domain containing ring finger 1, SH3 domain-containing RING finger protein 1, SH3 multiple domains 2, SH3MD2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH
• Quantity: 100 μg
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 57630
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified