SGLT2/SLC5A2 Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-15989-100UL

Product Code. 18373543

Description

SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Spezifikation

• Antigen: SGLT2/SLC5A2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS
• Quantity: 100 μg
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 6524
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified