missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFRS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | SFRS3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SFRS3 Polyclonal specifically detects SFRS3 in Human samples. It is validated for Western Blot.Specifications
| SFRS3 | |
| Polyclonal | |
| Rabbit | |
| P84103 | |
| 6428 | |
| Synthetic peptides corresponding to SFRS3(splicing factor, arginine/serine-rich 3) The peptide sequence was selected from the N terminal of SFRS3. Peptide sequence SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20 | |
| SRSF3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title