SFRS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57242

Product Code. 18282163

Description

SFRS3 Polyclonal specifically detects SFRS3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SFRS3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6428
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P84103
• Gene Symbols: SRSF3
• Immunogen: Synthetic peptides corresponding to SFRS3(splicing factor, arginine/serine-rich 3) The peptide sequence was selected from the N terminal of SFRS3. Peptide sequence SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Immunogen's sequence similarity with Goat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
• Isotype: IgG