missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFRS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57242
This item is not returnable.
View return policy
Description
SFRS3 Polyclonal specifically detects SFRS3 in Human samples. It is validated for Western Blot.
Specifications
| SFRS3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6428 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P84103 | |
| SRSF3 | |
| Synthetic peptides corresponding to SFRS3(splicing factor, arginine/serine-rich 3) The peptide sequence was selected from the N terminal of SFRS3. Peptide sequence SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS. | |
| 100 μL | |
| Primary | |
| Immunogen's sequence similarity with Goat: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction