missing translation for 'onlineSavingsMsg'
Learn More

SETD7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

£292.00 - £460.00

Specifications

Antigen	SETD7
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18449461 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-34101-25ul	25 μL	£292.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18112244 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-34101	0.1 mL	£460.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

SETD7 Polyclonal specifically detects SETD7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	SETD7
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	Q8WTS6
Gene ID (Entrez)	80854
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Epigenetics
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	EC 2.1.1.43, H3-K4-HMTase SETD7, histone H3-lysine 4-specific methyltransferase, histone-lysine N-methyltransferase SETD7, KIAA1717SET domain-containing protein 7, KMT7FLJ21193, Lysine N-methyltransferase 7, SET domain containing (lysine methyltransferase) 7, SET7/9Histone H3-K4 methyltransferase SETD7, SET7Set9, SET9
Gene Symbols	SETD7
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

SETD7 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents