missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SETD7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-34101
This item is not returnable.
View return policy
Description
SETD7 Polyclonal specifically detects SETD7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SETD7 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q8WTS6 | |
| SETD7 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS | |
| 0.1 mL | |
| Epigenetics | |
| 80854 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.1.1.43, H3-K4-HMTase SETD7, histone H3-lysine 4-specific methyltransferase, histone-lysine N-methyltransferase SETD7, KIAA1717SET domain-containing protein 7, KMT7FLJ21193, Lysine N-methyltransferase 7, SET domain containing (lysine methyltransferase) 7, SET7/9Histone H3-K4 methyltransferase SETD7, SET7Set9, SET9 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction