missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SETD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SETD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SETD4 Polyclonal specifically detects SETD4 in Human samples. It is validated for Western Blot.Specifications
| SETD4 | |
| Polyclonal | |
| Rabbit | |
| NP_059134 | |
| 54093 | |
| Synthetic peptide directed towards the C terminal of human C21ORF18. Peptide sequence LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4 | |
| SETD4 | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title