SerpinB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59086

Product Code. 18275193

Description

SerpinB2 Polyclonal specifically detects SerpinB2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SerpinB2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HsT1201, Monocyte Arg-serpin, PAI, PAI2Urokinase inhibitor, Placental plasminogen activator inhibitor, PLANH2PAI-2, plasminogen activator inhibitor 2, plasminogen activator inhibitor, type II (arginine-serpin), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 2, Serpin B2, serpin peptidase inhibitor, clade B (ovalbumin), member 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 92%; Equine: 92%; Pig: 92%; Bovine: 85%; Sheep: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P05120
• Gene Symbols: SERPINB2
• Immunogen: Synthetic peptides corresponding to SERPINB2(serpin peptidase inhibitor, clade B (ovalbumin), member 2) The peptide sequence was selected from the middle region of SERPINB2. Peptide sequence GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer
• Gene ID (Entrez): 5055
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.