missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Septin-6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Septin-6 Polyclonal specifically detects Septin-6 in Human samples. It is validated for Western Blot.Specifications
| Septin-6 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| 23157 | |
| Synthetic peptides corresponding to SEPT6(septin 6) The peptide sequence was selected from the N terminal of 40427. Peptide sequence TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA0128SEP2septin 2, MGC16619, MGC20339, SEPT2, septin 6, septin-6 | |
| 43349 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title