Septin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18453322	Novus Biologicals NBP1-90094-25ul	25 μL
18259656	Novus Biologicals NBP1-90094	0.1 mL

Description

Septin-4 Polyclonal specifically detects Septin-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Septin-4
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Apoptosis-related protein in the TGF-beta signaling pathway, ARTSPeanut-like protein 2, BRADEION, Bradeion beta, Brain protein H5, CE5B3, Cell division control-related protein 2, Cerebral protein 7, H5, hCDCREL-2SEP4, hucep-7, MART, peanut-like 2, peanut-like 2 (Drosophila), PNUTL2CE5B3 beta, septin 4, septin-4, septin-M
• Gene Symbols: SEPTIN4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5414
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only