missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | Septin-1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18355836
|
Novus Biologicals
NBP3-17043-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18351652
|
Novus Biologicals
NBP3-17043-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Septin-1 Polyclonal antibody specifically detects Septin-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Septin-1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, 40% glycerol | |
| 1731 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DIFF6SEP1, differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase), LARP, Peanut-like protein 3, PNUTL3MGC20394, septin 1, septin-1, Serologically defined breast cancer antigen NY-BR-24 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PVIGKADALMPQETQALKQKIRDQLKEEEIHIY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title