missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17043-25UL
This item is not returnable.
View return policy
Description
Septin-1 Polyclonal antibody specifically detects Septin-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Septin-1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DIFF6SEP1, differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase), LARP, Peanut-like protein 3, PNUTL3MGC20394, septin 1, septin-1, Serologically defined breast cancer antigen NY-BR-24 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PVIGKADALMPQETQALKQKIRDQLKEEEIHIY | |
| 25 μg | |
| Cell Cycle and Replication | |
| 1731 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction