missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Semaphorin 6B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Semaphorin 6B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18664376
|
Novus Biologicals
NBP2-37950-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18189367
|
Novus Biologicals
NBP2-37950 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Semaphorin 6B Polyclonal specifically detects Semaphorin 6B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Semaphorin 6B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9H3T3 | |
| 10501 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B, SEMAN, semaphorin VIB, semaphorin Z, semaphorin-6B, semaphorin-6Ba, SEMA-VIB, semaZ, SEM-SEMA-Y, UNQ1907/PRO4353 | |
| SEMA6B | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title