Semaphorin 6B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-37950

Product Code. 18189367

Description

Semaphorin 6B Polyclonal specifically detects Semaphorin 6B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Semaphorin 6B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9H3T3
• Gene Symbols: SEMA6B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 10501
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B, SEMAN, semaphorin VIB, semaphorin Z, semaphorin-6B, semaphorin-6Ba, SEMA-VIB, semaZ, SEM-SEMA-Y, UNQ1907/PRO4353
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.