missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Semaphorin 4F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | Semaphorin 4F |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643607
|
Novus Biologicals
NBP2-68815-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601107
|
Novus Biologicals
NBP2-68815 |
100 μg |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Semaphorin 4F Polyclonal antibody specifically detects Semaphorin 4F in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Semaphorin 4F | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10505 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| M-SEMA, m-Sema-M, PRO2353, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4F, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4F, Sema M, Sema W, SEMAM, semaphorin-4F, semaphorin-M, Semaphorin-W, SEMAWsemaphorin M | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title