missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Semaphorin 4F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68815-25ul
This item is not returnable.
View return policy
Description
Semaphorin 4F Polyclonal antibody specifically detects Semaphorin 4F in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Semaphorin 4F | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| M-SEMA, m-Sema-M, PRO2353, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4F, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4F, Sema M, Sema W, SEMAM, semaphorin-4F, semaphorin-M, Semaphorin-W, SEMAWsemaphorin M | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR | |
| 25 μL | |
| Neuroscience | |
| 10505 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction