missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEC11C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SEC11C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SEC11C Polyclonal specifically detects SEC11C in Mouse samples. It is validated for Western Blot.Specifications
| SEC11C | |
| Polyclonal | |
| Rabbit | |
| NP_079744 | |
| 90701 | |
| The immunogen for this antibody is Sec11c. Peptide sequence VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4, Microsomal signal peptidase 21 kDa subunit, SEC11 homolog C, SEC11 homolog C (S. cerevisiae), SEC11L3, SEC11-like protein 3, signal peptidase complex catalytic subunit SEC11C, SPase 21 kDa subunit, SPC21SEC11-like 3 (S. cerevisiae), SPCS4CSEC11-like 3 | |
| SEC11C | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title