missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCN11A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | SCN11A |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18664606
|
Novus Biologicals
NBP2-48665-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648796
|
Novus Biologicals
NBP2-48665 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SCN11A Polyclonal antibody specifically detects SCN11A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SCN11A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 11280 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| hNaN, NaN, Nav1.9, Peripheral nerve sodium channel 5, PN5, SCN12A, SNS2, SNS-2, sodium channel, voltage-gated, type XI, alpha polypeptide, sodium channel, voltage-gated, type XI, alpha subunit, sodium channel, voltage-gated, type XII, alpha, voltage-gated sodium channel Nav1.9, Voltage-gated sodium channel subunit alpha Nav1.9, voltage-gated, type XII, alpha polypeptide | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PLKKLYEPIVTTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title