missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCN11A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48665-25ul
This item is not returnable.
View return policy
Description
SCN11A Polyclonal antibody specifically detects SCN11A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SCN11A | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| hNaN, NaN, Nav1.9, Peripheral nerve sodium channel 5, PN5, SCN12A, SNS2, SNS-2, sodium channel, voltage-gated, type XI, alpha polypeptide, sodium channel, voltage-gated, type XI, alpha subunit, sodium channel, voltage-gated, type XII, alpha, voltage-gated sodium channel Nav1.9, Voltage-gated sodium channel subunit alpha Nav1.9, voltage-gated, type XII, alpha polypeptide | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PLKKLYEPIVTTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD | |
| 25 μL | |
| Signal Transduction | |
| 11280 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction