missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SC35 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£159.00 - £366.00
Specifications
| Antigen | SC35 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18661622
|
Novus Biologicals
NBP2-94309-0.02ml |
0.02 mL |
£159.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627142
|
Novus Biologicals
NBP2-94309-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SC35 Polyclonal antibody specifically detects SC35 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SC35 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| PR264, SC35, SC-35, serine/arginine-rich splicing factor 2, SFRS2, SFRS2A, splicing component, 35 kDa, splicing factor SC35, splicing factor, arginine/serine-rich 2, SR splicing factor 2, SRp30b | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SC35 (NP_001182356.1). MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6427 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title