missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SC35 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94309-0.02ml
This item is not returnable.
View return policy
Description
SC35 Polyclonal antibody specifically detects SC35 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SC35 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| PR264, SC35, SC-35, serine/arginine-rich splicing factor 2, SFRS2, SFRS2A, splicing component, 35 kDa, splicing factor SC35, splicing factor, arginine/serine-rich 2, SR splicing factor 2, SRp30b | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SC35 (NP_001182356.1). MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6427 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction