missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAPS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | SAPS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SAPS1 Polyclonal specifically detects SAPS1 in Human samples. It is validated for Western Blot.Specifications
| SAPS1 | |
| Polyclonal | |
| Rabbit | |
| KIAA1115MGC138185, PP6R1MGC142003, protein phosphatase 6, regulatory subunit 1, SAP190, SAPS domain family member 1, SAPS domain family, member 1, SAPS1serine/threonine-protein phosphatase 6 regulatory subunit 1 | |
| PPP6R1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 22870 | |
| Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title