missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£222.00 - £513.00
Specifications
| Antigen | SAH3 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18193288
|
Novus Biologicals
NBP2-47293 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18682026
|
Novus Biologicals
NBP2-47293-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SAH3 Polyclonal specifically detects SAH3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SAH3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| adenosylhomocysteinase-like 2, AdoHcyase 3, ADOHCYASE3, EC 3.3.1.1, FLJ21719, KIAA0828S-adenosylhomocysteine hydrolase-like 2, putative adenosylhomocysteinase 3, S-adenosylhomocysteine hydrolase-like protein 2, S-adenosyl-L-homocysteine hydrolase 3 | |
| AHCYL2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 23382 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title