missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-47293-25ul
This item is not returnable.
View return policy
Description
SAH3 Polyclonal specifically detects SAH3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SAH3 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| adenosylhomocysteinase-like 2, AdoHcyase 3, ADOHCYASE3, EC 3.3.1.1, FLJ21719, KIAA0828S-adenosylhomocysteine hydrolase-like 2, putative adenosylhomocysteinase 3, S-adenosylhomocysteine hydrolase-like protein 2, S-adenosyl-L-homocysteine hydrolase 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23382 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AHCYL2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction