SACM1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-81470

Product Code. 18217216

Description

SACM1L Polyclonal specifically detects SACM1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SACM1L
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DKFZp686A0231, EC 3.1.3, EC 3.1.3.36, EC 3.1.3.77, KIAA0851suppressor of actin 1, phosphatidylinositide phosphatase SAC1, SAC1 suppressor of actin mutations 1-like (yeast), SAC1EC 3.1.3.-, Suppressor of actin mutations 1-like protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SACM1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS
• Quantity: 0.1 mL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 22908
• Target Species: Human
• Isotype: IgG

For Research Use Only