SACM1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18470261	Novus Biologicals NBP1-81470-25ul	25ul
18217216	Novus Biologicals NBP1-81470	0.1 mL

Description

SACM1L Polyclonal specifically detects SACM1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SACM1L
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DKFZp686A0231, EC 3.1.3, EC 3.1.3.36, EC 3.1.3.77, KIAA0851suppressor of actin 1, phosphatidylinositide phosphatase SAC1, SAC1 suppressor of actin mutations 1-like (yeast), SAC1EC 3.1.3.-, Suppressor of actin mutations 1-like protein
• Gene Symbols: SACM1L
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 22908
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only