missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RWDD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | RWDD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RWDD1 Polyclonal specifically detects RWDD1 in Human samples. It is validated for Western Blot.Specifications
| RWDD1 | |
| Polyclonal | |
| Rabbit | |
| A8MT24 | |
| 51389 | |
| Synthetic peptides corresponding to RWDD1(RWD domain containing 1) The peptide sequence was selected from the middle region of RWDD1. Peptide sequence KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DFRP2, DRG family-regulatory protein 2, PTD013, RWD domain containing 1, RWD domain-containing protein 1 | |
| RWDD1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title