RWDD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56862

Product Code. 18284805

Description

RWDD1 Polyclonal specifically detects RWDD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RWDD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DFRP2, DRG family-regulatory protein 2, PTD013, RWD domain containing 1, RWD domain-containing protein 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Pig: 92%; Xenopus: 78%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A8MT24
• Gene Symbols: RWDD1
• Immunogen: Synthetic peptides corresponding to RWDD1(RWD domain containing 1) The peptide sequence was selected from the middle region of RWDD1. Peptide sequence KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ.
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 51389
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.