missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RSPH10B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RSPH10B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RSPH10B Polyclonal specifically detects RSPH10B in Human samples. It is validated for Western Blot.Specifications
| RSPH10B | |
| Polyclonal | |
| Rabbit | |
| B2RC85 | |
| 222967 | |
| Synthetic peptides corresponding to RSPH10B(radial spoke head 10 homolog B (Chlamydomonas)) The peptide sequence was selected from the middle region of RSPH10B. Peptide sequence EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC50833, radial spoke head 10 homolog B, radial spoke head 10 homolog B (Chlamydomonas), radial spoke head 10 homolog B2, RSPH10B2 | |
| RSPH10B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title