RSPH10B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56466

Product Code. 18284531

Description

RSPH10B Polyclonal specifically detects RSPH10B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RSPH10B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC50833, radial spoke head 10 homolog B, radial spoke head 10 homolog B (Chlamydomonas), radial spoke head 10 homolog B2, RSPH10B2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 222967
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B2RC85
• Gene Symbols: RSPH10B
• Immunogen: Synthetic peptides corresponding to RSPH10B(radial spoke head 10 homolog B (Chlamydomonas)) The peptide sequence was selected from the middle region of RSPH10B. Peptide sequence EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Mouse: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG