missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RSBN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RSBN1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
RSBN1 Polyclonal specifically detects RSBN1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| RSBN1 | |
| Unconjugated | |
| RUO | |
| DKFZp781E21150, FLJ11220, ROSBIN, round spermatid basic protein 1, RP11-324J2.1 | |
| RSBN1 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q5VWQ0 | |
| 54665 | |
| Synthetic peptides corresponding to RSBN1 (round spermatid basic protein 1) The peptide sequence was selected from the N terminal of RSBN1)(50ug). Peptide sequence GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title