RSBN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57724

Product Code. 18279264

Description

RSBN1 Polyclonal specifically detects RSBN1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: RSBN1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp781E21150, FLJ11220, ROSBIN, round spermatid basic protein 1, RP11-324J2.1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54665
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, KnockDown
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, KnockDown Validated
• Gene Accession No.: Q5VWQ0
• Gene Symbols: RSBN1
• Immunogen: Synthetic peptides corresponding to RSBN1 (round spermatid basic protein 1) The peptide sequence was selected from the N terminal of RSBN1)(50ug). Peptide sequence GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG