missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | RPL30 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RPL30 Polyclonal specifically detects RPL30 in Human samples. It is validated for Western Blot.Specifications
| RPL30 | |
| Polyclonal | |
| Rabbit | |
| P62888 | |
| 6156 | |
| Synthetic peptides corresponding to RPL30(ribosomal protein L30) The peptide sequence was selected from the middle region of RPL30. Peptide sequence LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 60S ribosomal protein L30, ribosomal protein L30 | |
| RPL30 | |
| IgG | |
| 13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title