RPL30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52873

Product Code. 18213293

Description

RPL30 Polyclonal specifically detects RPL30 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPL30
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 60S ribosomal protein L30, ribosomal protein L30
• Host Species: Rabbit
• Molecular Weight of Antigen: 13 kDa
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6156
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P62888
• Gene Symbols: RPL30
• Immunogen: Synthetic peptides corresponding to RPL30(ribosomal protein L30) The peptide sequence was selected from the middle region of RPL30. Peptide sequence LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.