missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPB8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | RPB8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
RPB8 Polyclonal specifically detects RPB8 in Human samples. It is validated for Western Blot.Specifications
| RPB8 | |
| Polyclonal | |
| Purified | |
| RUO | |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3, hsRPB8, II, and III 17.1 kDa polypeptide, II, and III subunit ABC3, polymerase (RNA) II (DNA directed) polypeptide H, RPB8 homolog | |
| POLR2H | |
| IgG | |
| Protein A purified | |
| 17 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P52434 | |
| 5437 | |
| Synthetic peptides corresponding to POLR2H(polymerase (RNA) II (DNA directed) polypeptide H) The peptide sequence was selected from the N terminal of human POLR2H. Peptide sequence DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE. | |
| Primary | |
| This product is specific to Subunit or Isoform: RPABC3. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title