missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF98 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RNF98 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RNF98 Polyclonal specifically detects RNF98 in Human samples. It is validated for Western Blot.Specifications
| RNF98 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| A6NDD0 | |
| 55521 | |
| Synthetic peptides corresponding to TRIM36(tripartite motif-containing 36) The peptide sequence was selected from the middle region of TRIM36. Peptide sequence GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| E3 ubiquitin-protein ligase TRIM36, EC 6.3.2.-, RBCC728RNF98HAPRIN, RING finger protein 98, tripartite motif containing 36, tripartite motif protein 36, tripartite motif-containing 36, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728 | |
| TRIM36 | |
| IgG | |
| 7 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title