RNF98 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54924

Product Code. 18275002

Description

RNF98 Polyclonal specifically detects RNF98 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF98
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase TRIM36, EC 6.3.2.-, RBCC728RNF98HAPRIN, RING finger protein 98, tripartite motif containing 36, tripartite motif protein 36, tripartite motif-containing 36, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728
• Host Species: Rabbit
• Molecular Weight of Antigen: 7 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 55521
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A6NDD0
• Gene Symbols: TRIM36
• Immunogen: Synthetic peptides corresponding to TRIM36(tripartite motif-containing 36) The peptide sequence was selected from the middle region of TRIM36. Peptide sequence GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.