missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF39 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RNF39 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RNF39 Polyclonal specifically detects RNF39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RNF39 | |
| Polyclonal | |
| Rabbit | |
| A2BEK3 | |
| 80352 | |
| Synthetic peptides corresponding to RNF39(ring finger protein 39) The peptide sequence was selected from the N terminal of RNF39. Peptide sequence EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| HZF, HZFWLTP (long-term potentiation) induced RING finger protein, LIRFHZFw1, Protein HZFw, ring finger protein 39 | |
| RNF39 | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title