RNF39 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55282

Product Code. 18295261

Description

RNF39 Polyclonal specifically detects RNF39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RNF39
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HZF, HZFWLTP (long-term potentiation) induced RING finger protein, LIRFHZFw1, Protein HZFw, ring finger protein 39
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: A2BEK3
• Gene Symbols: RNF39
• Immunogen: Synthetic peptides corresponding to RNF39(ring finger protein 39) The peptide sequence was selected from the N terminal of RNF39. Peptide sequence EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80352
• Target Species: Human, Equine
• Isotype: IgG