missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RMD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RMD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RMD1 Polyclonal specifically detects RMD1 in Human samples. It is validated for Western Blot.Specifications
| RMD1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CGI-90, family with sequence similarity 82, member B, FLJ20665, hRMD-1, microtubule-associated protein, Protein FAM82B, regulator of microtubule dynamics 1, regulator of microtubule dynamics protein 1, RMD1, RMD-1 | |
| FAM82B | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96DB5 | |
| 51115 | |
| Synthetic peptides corresponding to FAM82B(family with sequence similarity 82, member B) The peptide sequence was selected from the N terminal of FAM82B. Peptide sequence MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title