RMD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57839

Product Code. 18214845

Description

RMD1 Polyclonal specifically detects RMD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RMD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CGI-90, family with sequence similarity 82, member B, FLJ20665, hRMD-1, microtubule-associated protein, Protein FAM82B, regulator of microtubule dynamics 1, regulator of microtubule dynamics protein 1, RMD1, RMD-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51115
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96DB5
• Gene Symbols: FAM82B
• Immunogen: Synthetic peptides corresponding to FAM82B(family with sequence similarity 82, member B) The peptide sequence was selected from the N terminal of FAM82B. Peptide sequence MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG